PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G007300.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 608aa    MW: 68202.8 Da    PI: 8.1493
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G007300.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.3e-133175146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        + rW++eE ell ++v+++G+++W+ I+  ++  R +  c srw  
  Sevir.1G007300.3.p 31 KCRWSPEENELLTQLVHKHGTKNWHNISCAIP-DRNAHACLSRWKY 75
                        569*****************************.***********85 PP

2Myb_DNA-binding40.85e-1383125145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         + +W+++E+++l++a++ +G++ W +  ++++ gRt + +k++w+
  Sevir.1G007300.3.p  83 KEAWSQQEELRLIRAHQIYGNK-WCKMVKHFP-GRTNNALKEHWR 125
                         579*******************.*********.***********7 PP

3Myb_DNA-binding414.6e-13290333145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +grW +eE ++l + v+++G ++W tIa+ ++  R + qc+ rw 
  Sevir.1G007300.3.p 290 KGRWLAEENKILTKMVTKHGLKNWQTIASAIP-SRNAQQCRIRWT 333
                         79******************************.***********5 PP

4Myb_DNA-binding36.41.2e-11343384245
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           W++eE+++l++a++ +G+  W +  ++++ gRt   +k++w+
  Sevir.1G007300.3.p 343 EDWSEEEELKLIRAHQIYGSQ-WLKMVKHFP-GRTNHALKEHWR 384
                         67*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1772677IPR017930Myb domain
SuperFamilySSF466892.97E-2529124IPR009057Homeodomain-like
SMARTSM007171.8E-113079IPR001005SANT/Myb domain
CDDcd001675.49E-103377No hitNo description
Gene3DG3DSA:1.10.10.605.4E-183384IPR009057Homeodomain-like
PfamPF139215.0E-143494No hitNo description
PROSITE profilePS5129420.60878132IPR017930Myb domain
SMARTSM007174.3E-1382130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-1785132IPR009057Homeodomain-like
CDDcd001671.81E-985125No hitNo description
PROSITE profilePS5129412.365285336IPR017930Myb domain
SMARTSM007177.9E-12289338IPR001005SANT/Myb domain
SuperFamilySSF466891.54E-23289383IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-20291343IPR009057Homeodomain-like
CDDcd001673.90E-9292336No hitNo description
PfamPF139215.1E-15293353No hitNo description
PROSITE profilePS5129418.766337391IPR017930Myb domain
SMARTSM007178.8E-11341389IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-16344391IPR009057Homeodomain-like
CDDcd001671.37E-8345384No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MESENTEVPP QKKNVHGFNE CSSLKNLERT KCRWSPEENE LLTQLVHKHG TKNWHNISCA  60
IPDRNAHACL SRWKYVLDPA INKEAWSQQE ELRLIRAHQI YGNKWCKMVK HFPGRTNNAL  120
KEHWRGSMKR KLDSYLASGL LEQVPDLHEN LSVLQSSQSD SPKDSKVSSD RSQFSSILST  180
RSKLKQEIRE LSENADTSVG ESSDFIYAKA LDTHSAKVSE SIITKPQQCA RARKKLDSVS  240
TPVKLKSDLP PETVKCRQEM ESGKTEGPPC KKNGYCFKEG SSLKNSETTK GRWLAEENKI  300
LTKMVTKHGL KNWQTIASAI PSRNAQQCRI RWTRSLDPAI NKEDWSEEEE LKLIRAHQIY  360
GSQWLKMVKH FPGRTNHALK EHWRGRMKGK LNYYLASGRL EEITDLKEDI SVPESSQSDI  420
PKDSQGSSER NRPPSSLPPR PKSKSDLSEL DENADTSEEE SSDCIYPKGL DAHSAKVSEK  480
IMAKSKQRAR ARKKLDFLST PVELKVCTAA ASCQRPPPKM EQTTPASDNS SPSDVCQGIP  540
QNAASEPVDV VIPTAASNHP NDVHSLATPD PCSLEIHEAD ASDLLDMSYC DGLMIDSPLY  600
LHGSSFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-21343924110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698302.10.0PREDICTED: snRNA-activating protein complex subunit 4-like isoform X2
TrEMBLA0A0A9FY270.0A0A0A9FY27_ARUDO; Uncharacterized protein
STRINGSi017903m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.18e-38myb domain protein 3r-4